SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087E6H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087E6H9
Domain Number 1 Region: 33-110
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.000000000005
Family DHN aldolase/epimerase 0.0021
Further Details:      
 
Domain Number 2 Region: 190-319
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.000000000641
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087E6H9
Sequence length 343
Comment (tr|A0A087E6H9|A0A087E6H9_9BIFI) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e pyrophosphokinase {ECO:0000313|EMBL:KFJ03380.1} KW=Complete proteome OX=79262 OS=Bifidobacterium thermacidophilum subsp. thermacidophilum. GN=THER5_0839 OC=Bifidobacterium.
Sequence
MDSIRLTGIRAAAGQGGSPSACSGHDDAPRWRDLRADVTVTLDLREAIAADDITQTVDYA
QLTDRVRQVMAAGAYECALVETIAGRIAQAVLLSHRVHSVDVVLHAGHPHGADIDEIVVN
VHRMADDDSRVGATPAAQASGLVPRQDRSESDGDAYAGNPSDGGRHSASQSGVPSGHANP
TQVPVQQPSHAVIAMRGGSGDGEHLMRAAVVALDSVPGNQVTGISPLYHVSAIDGPDSMS
AVVLVDTRLDLAALSHLLASINDKHRDTLALHAVTMRSDAEGGRHEQVGWQEAKTKASIL
APWMDIEPDASFDGDPLSYLLALAPDATQVGLLSDSWILGGMQ
Download sequence
Identical sequences A0A087E6H9
WP_029575898.1.27126 WP_029575898.1.28884 WP_029575898.1.4237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]