SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087WS45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WS45
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily ALDH-like 0.0000445
Family ALDH-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087WS45
Sequence length 72
Comment (tr|A0A087WS45|A0A087WS45_MOUSE) Aldehyde dehydrogenase family 3 member B3 {ECO:0000313|Ensembl:ENSMUSP00000140893} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=1700055N04Rik OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSTKGKHPRADQGTDPFEEKLQRLKEAFNTGKTKTAKFRAEQLQSLGRFLQDNSKQLHDA
LDGDLGKASSQT
Download sequence
Identical sequences A0A087WS45
ENSMUSP00000140893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]