SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087WTE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WTE0
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000131
Family ALDH-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087WTE0
Sequence length 66
Comment (tr|A0A087WTE0|A0A087WTE0_HUMAN) Aldehyde dehydrogenase family 3 member B1 {ECO:0000313|Ensembl:ENSP00000477789} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH3B1 OC=Catarrhini; Hominidae; Homo.
Sequence
LALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAG
SASESG
Download sequence
Identical sequences A0A087WTE0 A0A2J8U0L6
ENSP00000477789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]