SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087X139 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X139
Domain Number 1 Region: 36-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-56
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087X139
Sequence length 255
Comment (tr|A0A087X139|A0A087X139_HUMAN) Triple functional domain protein {ECO:0000313|Ensembl:ENSP00000483869} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TRIO OC=Catarrhini; Hominidae; Homo.
Sequence
MALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVET
ERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLED
PEKLGSLFVKHERRLHMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKP
VQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGRVVA
LCHRFKETFREICWF
Download sequence
Identical sequences A0A087X139
ENSP00000483869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]