SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087X297 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X297
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-23
Family Cystathionine synthase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087X297
Sequence length 236
Comment (tr|A0A087X297|A0A087X297_HUMAN) Kynureninase {ECO:0000313|Ensembl:ENSP00000484801} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KYNU OC=Catarrhini; Hominidae; Homo.
Sequence
ADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAI
YFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEK
EIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRM
IKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKVV
Download sequence
Identical sequences A0A087X297
ENSP00000484801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]