SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087XJ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XJ87
Domain Number 1 Region: 675-798
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.07e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 984-1078
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 20-101
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-20
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 202-316
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000984
Family Phosphotyrosine-binding domain (PTB) 0.035
Further Details:      
 
Domain Number 5 Region: 930-998
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000413
Family UBX domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XJ87
Sequence length 1289
Comment (tr|A0A087XJ87|A0A087XJ87_POEFO) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSPFOP00000005840} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MRIQGQPEGARRRLDMNATGELRDVEVIRGRAGYGFTITGQKPCLLSGIMEGSPAFVVGL
RQGDRIMAINGADVSAASHETVVQLIGGCKGPLHMVVLSERRIMGNPILNDAKFGFEQKS
SVFQKPGVLRAVSHDPSRPSFDPNNGVTAKQRPVSEPDMSLWTQQFNVLSGKKKEETPTV
KDTDSVFSDTEEVNPDWSVLNMTLVVGYLSSTELILNTGDTEDDCLKAIRERIRQLGTEQ
DTHTLVMMKVMFDCIRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIINGRVP
DDGPLRASCHVFFIDPDLGNHKDHIGIACRFGFNCTPDPDSLGCLEFPQTPPDVLHFVTV
LYSDLGEAVERLRAKLDMEAQQTDSTSKLGSASSNGDSGIENSSPPEERADRDFPSDIPN
LSGTHLPSCPWDYPSTEVVTPVNPVKNGQKLEPENSASPHSLSESLPGPDSLTSFYGGPP
PRLEFHFKPPPPPLPLSKKPNFLAYPLRSSQRWFSKPKWPKTLSSDSVNQETSTNINSTT
NNPPSALNQAHSDRYHSTEAMMPPREEWTKRFLEQRQKQRADGSYRNLQKTTLDRKLSKL
QGSRFWGIGVTRASKRRSSKRLSMARSLDDLESAASSDGDYSGIQLQGCCSHSSLTSNGS
LPGAGGHRGSADHRVAGWSTCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHV
PATDKKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPQPEMFKTQQLQIFNLM
KFDSYSRFLKSSLYLECLRAEEDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKVDTQ
DIRKQRSGKSLNEDTKDESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDFWGSNGRRE
SQGSLSSSASLEIPNSVSAAKMEEQYKQRHCSVLLPDSSCSSITLRPGASIREVLQDLCR
NICVNIAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPT
KPVTEVLRPVVAKYGLNLGDLVAKISGETEPLDLGAPISSLDGLRVVLEQADPCSGKEIT
EKMLGRFAKDTNAITSDHQYHQLIIGQQKALIKTRSRQMDEGDERSAPKDISVRAAGPAS
ALPGEKRKQKKINIDEAEEFFELLSRAQSTRANDQRGLLKKEDLVLPDFLRLTPPTSSCS
ASSNLACSTPASLKPSRENGVPPRGSLTAALRSESLDSSLSSSANGHSASRRCLLPSLRT
VEEDAHADLTLVGEGDISSPNSTLLPPSP
Download sequence
Identical sequences A0A087XJ87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]