SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087Y801 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y801
Domain Number 1 Region: 439-575,604-671
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-37
Family Hemopexin-like domain 0.00086
Further Details:      
 
Domain Number 2 Region: 63-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000144
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 22-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000157
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087Y801
Sequence length 674
Comment (tr|A0A087Y801|A0A087Y801_POEFO) Proteoglycan 4b {ECO:0000313|Ensembl:ENSPFOP00000014154} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSSKTFMVATLLVCALKFISSQTSCRGRCGAEYYRGNMCQCDFTCLSYDECCNDYEAQCT
TKNSCKGRCGETFKRGRRCTCDFECSKFKQCCPDFKNHCDVDVITAEKSGGATGPMTGSS
CDNVHNNPKDSTAAKDPELSEGNNADDSLFTPDSLTPYPPMDLDDGDDIFAEIFPNDDLS
TNGDVQPEASPTPEVSSGDGLTPVEPLDEIPTEPTLIRDDPQFNTEPTPVDDIFTLAAVT
TGRTDPTEPTSVDPDQTTTPLVPSEPNSGVLDLSLTSELQTEPTASSGASAIETEISPSD
APEVSHTNAKDLMEELENSQLTTTSGLSTLASVTEETTSSPNTESSPESITTSSPDVLQD
VSDATLTPAGDELLSSTAAAPDSASGGVNPDETTAEPDSKPDPSKASPTSKPESKPLEPQ
TQITDNLKDYQGDDSDDTNLCSGRPVSGITTLRNGTMVVFRGHYFWVLDRNLVPSSPKGI
TAVWGVPSPIDTVFTRCNCQGKTYIFKGGKYWRFENDALDPGYPKVVKTGFDGLQGHITA
ALSVPQYLSRKESVYFFKRGGTVQKYSYQFGTSPKCGRTANVPVYTVRARLVRQAVSVLE
PAINIRRSWKGFPSTITAAVSVPTNRNPEGYKYVVFSRSTAYNVRMHDGRPVVAAPRANV
SPKTDNFFRCPKKS
Download sequence
Identical sequences A0A087Y801
XP_016526347.1.10163 XP_016526348.1.10163 XP_016526349.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]