SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087Y8W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y8W6
Domain Number 1 Region: 752-900
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-37
Family Regulator of G-protein signaling, RGS 0.0000737
Further Details:      
 
Domain Number 2 Region: 1089-1185
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-28
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 256-398
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-21
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 4 Region: 12-97
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 5 Region: 1035-1103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000241
Family Ras-binding domain, RBD 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087Y8W6
Sequence length 1421
Comment (tr|A0A087Y8W6|A0A087Y8W6_POEFO) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSPFOP00000014469} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
AFPQPPQLASAAQYGRIQAVEVARGRTGYGFTLTGQSPCVLSCILKGSPADYVGLRSGDC
ILSVNDINVSKASHEDVVKLIGRCSGILKLVIAEGERHRRHPDSCSSDDELDVFYNNGCG
PKGGWYKPKVDSKQLGINRAEKVVAELQSGGIFNMIFENSSHSSSSSDKDRPGVSSSSKP
HQMSDPEFNPYRSASCTQSNPNLLSEEEMAQVLNDDSVFLESDFRHLHIHHHEEQDMDVG
EGADFGLEPSEGILNVGMIVGYLGSIELASTGTNLENDSLQAIRGSMRRLRAEQKIHSLV
LMKVMHDSVLLCSDRGQVLATYPAEKLAFSACCPDDRRFFGLVTMQATDDHDDRHFSNGR
DDEGSLRTSCHVFIVDPELCHHQVHSGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFVS
VLYRDMGDNIEGVRARAFHDPDNDAQQNHSTSSNSDSGIGNFLPEEKSNRVLLVDLGGPP
SHNHMSGARQWDSPPSSQQAWSPILGAAASHPPPPPPPPPMLRNGHYLHDPHLADLPHPL
PLAHPDLPSRLSQGLNVHHYPARKLGGAMPQRWLPVHVLRDWRQQHQQHQHHHSHFQGLS
SDQESYAESTDGWSSANCSTLPPPMNKIPADRYRAPLAPDLHSHRLAAQKDEWAKKLFGA
GDRERSGARRAEKEKKREANSKEGEKKGGRFRGLTMGFPPLPHRSSARRSFGRSKRLSMA
RSLDNLESAAVSDGELNSVELQGCSSDNSLNSNASLPSVQSHRRHTERRVASWAVCFERL
LQDPVGVRYFSEFLKKEFSEENILFWQACEFFSHVSENDNKQLSQRAREIYNSFLSSKAT
TPVNIDSQAQLADDILNAPKPDMFKEQQLQIFNLMKFDSYTRFLKSRLYQECMLAEVEGR
PLPDPYHIPSSPTSKHSTTGSDRSNLSTPKKLQEDKKTKSGRSLNEDSRDDSGDRRKGMF
FSWSRNRSFGKGPKKRELADFNYICVFSGTNGRRESQGSLSSGASLELGTSGSGKNEHEA
AFNHERGGGSAPLRQCNISLPDGSCCPVPLRPGMSIRDLLQGLCDKLCINLAAIDLFLVG
GEKPLVLDQDCMTLSSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYG
LHLSDLVARISGESEPLDLGLPISNLDGLRVVLDTEENAMGKDKIKAAQSHLPASASRNQ
SATGDDRPTRKGGSAHPHGAPGKRKQKKINIDEAEEFFDLISKAQSNRADDQRGLLNKSD
LQLPDFLRLTPTSPTTPAPLNAEPICSTPNSRNTDNGGFPSSSHRGNKLSASHQSQSLDS
ALGAECGGGRKTRPPPPFPATVSPIQSTRPSAQGLLQDSARGESIQMLEEDALSDLTLVG
EGDINSPSLNYITPSSLSSKPLPRPQHEAQDGRPCSGTSPV
Download sequence
Identical sequences A0A087Y8W6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]