SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088E3B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088E3B1
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.41e-48
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000357
Further Details:      
 
Domain Number 2 Region: 171-277
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 4.06e-32
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088E3B1
Sequence length 278
Comment (tr|A0A088E3B1|A0A088E3B1_9CREN) Molybdopterin dehydrogenase, FAD-binding protein {ECO:0000313|EMBL:AIM26771.1} KW=Complete proteome OX=43687 OS=Metallosphaera sedula. GN=HA72_0609 OC=Metallosphaera.
Sequence
MYPPKFGYVIPDSVDEANEFLEKHEDAKALAGGHSLIPMLKLRILRPSYLVELKGLNDLH
FIKKEEGKIRIGALTTHYEIVKANLPLLSEAGATVADPQVRNMGTIGGVISHLDPAADYP
ASLIAMDAVVRIKGTRGEREEPFKDFAKDMFSPDLNPGELVKEVIIPGFKGYSFSYKKLE
RRAGDYAIVGVAVLLKKEAGVVKDVRIGLTAVNNKAVRASEAEKVLLDRSPDEKLIEEAA
EKAMSYANPTSDIRGSAEYKKKMTRVMTKRALQDALTR
Download sequence
Identical sequences A0A088E3B1 A4YED2
WP_012020571.1.15515 WP_012020571.1.27320 WP_012020571.1.28583 WP_012020571.1.31166 WP_012020571.1.34633 WP_012020571.1.8883 WP_012020571.1.99084 gi|146303392|ref|YP_001190708.1| 399549.Msed_0609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]