SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A090XEN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090XEN1
Domain Number 1 Region: 247-497
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-53
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 551-806
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-48
Family YWTD domain 0.00000701
Further Details:      
 
Domain Number 3 Region: 4-195
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-42
Family YWTD domain 0.00000727
Further Details:      
 
Domain Number 4 Region: 855-1106
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-36
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1158-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1198-1242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 505-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000329
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 808-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000133
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 1232-1268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000114
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 10 Region: 201-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000768
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1117-1155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000445
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090XEN1
Sequence length 1315
Comment (tr|A0A090XEN1|A0A090XEN1_IXORI) Putative low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:JAC93158.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
VASMGVVSPDGLACDWIGRKLYWTDSDTNRIEVSQLDGSHRKVLFWKDLDQPRAITLVPT
EGLMFWTDWGETPKIERASMDGNPGTRKIIVREDIFWPNGLTVDYGAKRIYWADAKLRFI
SSMDYDGAGRAVVIQGSLPHPFALTVHGDTLYWTDWQAKAVQSCSKLTGTHKRIVLSGDL
EPMDIHAYGPLRQPTGDSSSPCGYNNGGCSHLCLLSSVTPFFSCACPSGVRLLNDTRTCA
SGAREILLLARRTDLRRISLDMPDYTDVVLPLRGIKHAIAIDYDPVEGRIYWTDDEVCVI
QRAYLNGSNQEPVVTSEVQHPDGMAVDWIARNLYWTDTGTDRIEVARLNGTSRKVLISED
LGEPRAIVLDPPKGYMYWTDWGNAPKIERAALDGGQRRVLVSTGLGWPNGLAIDTRAGKL
YWADARMDRIETASVDGTGRKVLVSDQLPHVFGFTLLGEYMYWTDWQGRSIERVHKDTGG
QRQVIIDQLPDLMGLKAVNVHEAHGTNPCAVSNGGCSHLCLNRPNGEAPACACPTGLELR
EDLRTCTATEAFLLYVQREDIWRISLQSRRKDHVPLSGVMEAAALDYDVSDGRIYWTDTG
LKRISRAFLNGSQPQTLVEFGLDYPEGMAVDWVAHNLYWVDMGLKRLEVSRLDGSSRRVL
LWKGLDDPRSLALDPSHKFMYWSDWGKAPRIERAALDGSQRVRLITKIARANSLTIDHVD
RRLYWTASDSNLIESSDMSGDGRRVVVHSEALRPYGLTQYQEYIYWTDLATKSIERADKS
SGSNRTRLLGQLKYSDDILVFHTSRQAGWNQCALYNGGCSHLCLGVPGPRGYQCACPTHQ
PLGPNNKTCLRPSSFLLFSQKTVINRIEVDVEDSPDVVLPIHGLKNIRALEYDFVSNFVY
WVDGKARTIRRSHDNGTGSSVVVGNPGEALHPHSLALDPYGRQLFWTCALGNVINATSLD
DGRPLGVILGGKDERPRLLALHPHQGLLFWTNLVNPALIERAYLDGKNRKTLVSNDLRAP
GALTVDAEGDLLFWSDLELRRVERIRVTGDGRKILLANVQANALTVSGPHLYIMDRTEQC
IHRTDKQTGDSVWTVLSRRSHLSDILAVSRPERPEAHPCVRHSCSHLCLPGPRDRHQCAC
PAGLVLEAGDERRCAPAPTCTAEQFACAGGKHACIPLAWRCDGSFECEDHSDERDCPTCG
PHEFRCNDGGCVAKSRLCDGTADCADESDEFCCRSMEVVCRTTHDCIDRSRVCDGRADCA
DGSDEKQCDGSTLRAPITAEKAGTTTVVVVAVVLVFALACFFSVALCCYLYHARG
Download sequence
Identical sequences A0A090XEN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]