SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091DQ95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DQ95
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-57
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 181-420
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 785-1044
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 2-130
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-28
Family YWTD domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1175-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1096-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1137-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1054-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091DQ95
Sequence length 1463
Comment (tr|A0A091DQ95|A0A091DQ95_FUKDA) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFO25001.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_13582 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
FMYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYEEQKLYWADAKLNFIHKSN
LDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMD
IHAFSQLRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKNGATEL
LLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFID
GSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRA
IVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAK
TDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIID
QLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSP
RALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDL
DTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTVIQ
GHLDYVMDILVFHSSRQAGWNECASSSGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCS
APTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIR
KAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPIGV
VLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALD
SRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKI
DMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSC
PMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSE
SQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVD
CSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMT
NDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASS
SSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTT
PCSTDVCDSDYAPSRRMTSGATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPS
PYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091DQ95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]