SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091DZS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DZS8
Domain Number 1 Region: 638-893
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000627
Further Details:      
 
Domain Number 2 Region: 26-286
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-54
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 337-567
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-51
Family YWTD domain 0.00000237
Further Details:      
 
Domain Number 4 Region: 940-1202
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-37
Family YWTD domain 0.000087
Further Details:      
 
Domain Number 5 Region: 1333-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1255-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 896-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 291-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000455
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1213-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091DZS8
Sequence length 1613
Comment (tr|A0A091DZS8|A0A091DZS8_FUKDA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_10177 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MQPLPFWNHVPTCSVLTVCFHPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAA
VDFQFSKGAVYWTDVSEEAIKQTYLNQTGVATQNVIVSGLVSPDGLACDWVGKKLYWTDS
ETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRK
IIVDSEIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSG
DTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTPCEEDNGGCS
HLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVL
QVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRARLDGSGAQTLVNTEINDPDGIAVDWVA
RNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGETPKIECA
NLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPH
IFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVIGTNPCAD
GNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDV
AIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDW
MGKNLFWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIV
RAFMDGTNCITLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPH
PFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLVQGHLDFVMDILVFHSSRQDGLNDCV
HSNGQCEQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKCAISRMIPDDQHSP
DLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGSQAGALTRRAFVLTSAGQSP
DRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAITVNAERGYLY
FTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLS
GANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTGIH
AVEEVNLEEFLAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPD
QFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEAD
CQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKPPSDETPA
HSSAIGPVIGIILTLFIMGGLYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGG
SQHGSFPGISCSKSMMSSVSLMGGRSGAPLYDRNHVTGASSSSSSSTKATLYPPILNPPP
SPATDPSLYNMDMFYSSNIPATTRSYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKY
YLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A091DZS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]