SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091F4W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091F4W2
Domain Number 1 Region: 618-873
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 7-266
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 316-552
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-50
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 4 Region: 921-1180
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 875-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1311-1349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1233-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 573-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000221
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1273-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 269-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1190-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000064
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091F4W2
Sequence length 1501
Comment (tr|A0A091F4W2|A0A091F4W2_CORBR) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFO56930.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_12185 OC=Corvus.
Sequence
VPCAAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLKGLIYWSDVSEEA
IKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFW
QELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQ
KLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYS
GEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGV
KLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYI
YWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNG
TMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNG
LALDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLEDYIYWTDWQRRS
IERVHKRTAEREIIIDQLPDLMGLKATNVHQVIGTNPCAEDNGGCSHLCLYRPQGLRCAC
PIGLELISDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDN
RIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKL
DGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRAN
GLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRS
IERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVC
GCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDP
LDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEA
TNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTERE
VLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFE
NWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGC
SHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFT
ECEDHSDEKNCPVCSDSQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCA
SGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFIC
QRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGG
SSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRS
Y
Download sequence
Identical sequences A0A091F4W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]