SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091FRX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FRX3
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-55
Family YWTD domain 0.00000515
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-50
Family YWTD domain 0.00000388
Further Details:      
 
Domain Number 3 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-48
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 870-1134
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-38
Family YWTD domain 0.0000706
Further Details:      
 
Domain Number 5 Region: 1265-1300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1227-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1186-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000531
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000344
Family EGF-type module 0.031
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1143-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000524
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091FRX3
Sequence length 1545
Comment (tr|A0A091FRX3|A0A091FRX3_9AVES) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFO71924.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_00221 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVFSPDRQPYYHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYFDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILVSENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDIEKDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCF
FTPQEIKCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYALDPNSGNCSSPASFLLFSQKSAISRMVPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQASLHGPFTVMGTPNQSQNPEKQPHDLS
IDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERA
PKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLE
DSNILQPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKRTRIQGRIAHLTGIHAVEELDME
EFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGE
IDCIPMAWRCDGFPECDDQSDEDNCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEA
DCDALCLPNQFRCASGQCILVKQQCDSFPDCIDGSDELMCEKSKPASDESQPHSSAIGPV
IGIILSLFVMGGMYFVCQRVVCQRYTGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTG
ISCGKSMISSMSLVGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSL
YNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDS
DPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091FRX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]