SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091GAW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GAW9
Domain Number 1 Region: 137-286,334-400
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.06e-26
Family Hemopexin-like domain 0.0026
Further Details:      
 
Domain Number 2 Region: 43-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.00098
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000235
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091GAW9
Sequence length 400
Comment (tr|A0A091GAW9|A0A091GAW9_9AVES) Proteoglycan 4 {ECO:0000313|EMBL:KFO79530.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_02411 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
DVSSCTGRCGEGYAREHVCHCDFNCQLYKECCPDFNKVCTVAASCRGRCFEAFERGRECD
CDKDCERYGKCCPDYVKECKEDEEKKPEEVTQPHEVMEGTHVNSSKANYVQFQTKSCYSE
HHKPKYLYLKVKDEKDLCNGKPADGMVALPNGTLAVFRVPFSLSIGPHAFHRLSSPQHNY
WLLNGRSPPTTNPRTIRDGWGIPGPINSVFSRCNCDGKIFFIKGPLYWRFTGGVMDKGYP
KPLANGFAGLSGKIVATLPVARYNTRPESVYFIKKDGNMQQYVYRQGPAKTCQRRTQVTI
RYPAYVPRLVIRRPATTPNLNFLLPAGILHKEIKVNAYWKGLPKVIHSTISLPNHNKPDG
YDYYAFSYNRYYSLDIGKRIARPVTALTGKTVSKDWYNCP
Download sequence
Identical sequences A0A091GAW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]