SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091H3S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091H3S4
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 181-411
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 784-1054
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-38
Family YWTD domain 0.0000811
Further Details:      
 
Domain Number 4 Region: 1-130
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-29
Family YWTD domain 0.0000926
Further Details:      
 
Domain Number 5 Region: 1185-1220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1147-1183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000283
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1106-1146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 740-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 135-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1063-1116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091H3S4
Sequence length 1465
Comment (tr|A0A091H3S4|A0A091H3S4_BUCRH) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFO90064.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_11924 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
YMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRAN
LDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMD
IQVLSPDRQPCFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEV
LLLARRTDLRRISLDTPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLD
GSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRA
IVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEKNKLYWGDAK
TDRIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIID
QLPDLMGLKATSVTKVLGTNPCAENNGGCSHLCFFTPQEARCACPIGLELLSDLKTCIIP
EAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAF
MNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNP
RSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDL
DTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQ
GHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSS
PASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKFIYWVDGRQNIIKR
AKDDGTQAMITGNCVVLQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNV
HRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTG
LIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWI
DRQQQMIERVEKVSGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRDNGGCSHICIA
KGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQS
DEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQFRCAGGQCIL
LKQQCDSFPDCMDGSDELMCEKSKPAPDESQPHSSAIGPVIGIILSLFVMGGMYFVCQRV
VCQRYTGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGA
PLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRP
YLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESC
PPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091H3S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]