SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091I575 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I575
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-49
Family YWTD domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-49
Family YWTD domain 0.00000244
Further Details:      
 
Domain Number 4 Region: 870-1129
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-40
Family YWTD domain 0.0000548
Further Details:      
 
Domain Number 5 Region: 1222-1258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 1181-1221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000075
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1138-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091I575
Sequence length 1540
Comment (tr|A0A091I575|A0A091I575_CALAN) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFP02560.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_06297 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANI
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPIMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKEKLYWGDAKTDKIEVINVDGTMRKTLVEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAESNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVRAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYS
HTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQDRAPKIER
AALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNIL
QPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVH
PCSHDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIP
MAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTI
CLPNQFRCASSQCILLKQECDSFPDCTDGSDELMCEKSKAASEESQPHSSAIGPVIGIIL
SLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGK
SMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATLYPQILNPPPSPATDRSLYNVEM
FCSSNIPSTARSYRPYLIRGIAPPTTPCSTDVCDSDHTTSRWKANKYYIDLNSDSDPYPP
PPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091I575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]