SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091KAB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KAB9
Domain Number 1 Region: 140-276,335-401
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.67e-35
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 43-85
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000068
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000759
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091KAB9
Sequence length 401
Comment (tr|A0A091KAB9|A0A091KAB9_COLST) Proteoglycan 4 {ECO:0000313|EMBL:KFP34417.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_05948 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
DLSSCTGRCGEGYSRENDCHCDFNCQHYMECCPDFKKVCTVAVSCKGRCFEAFERGRECD
CDADCERFGKCCPDYTEQCKADTRSWLLNEKKPKTKITKSNFKDKLAIFSSMNTSWVRAG
RYTGSLHRDKNSEKKKDEKDLCSGKPADGMVALPNGTLAVFRGHYYWLLNGRNPPTTNPR
RIRDGWGIPSPIDAVFSRCNCDGKTFFIKGPLYWRFTNGVMDKGYPKPLANGFAGLSGKI
MATLPVSRYNNRPESVYFIKKDGNMQQYVYKQEPAKKCQRRARVTIRYPAYVPRLVIRRR
FQRAVRMPTLIQTIRINPHPSGNSCLLRFLHKEIKLNSYWKGLPKVIHSTLSVPNYNKPD
GYDYYAFSYNRYYSLDVGKRIARPVTALTGKTVSKDWYNCP
Download sequence
Identical sequences A0A091KAB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]