SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091N7E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091N7E5
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-49
Family YWTD domain 0.00000436
Further Details:      
 
Domain Number 3 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 4 Region: 870-1138
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-38
Family YWTD domain 0.000086
Further Details:      
 
Domain Number 5 Region: 1269-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1231-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1190-1230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000377
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1147-1200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091N7E5
Sequence length 1549
Comment (tr|A0A091N7E5|A0A091N7E5_9PASS) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFP84942.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03435 OC=Acanthisitta.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGAGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGEIPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNPCAENNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQASLHLIYSFPFTVMSTPNQSQNPEKQP
HDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNM
QERAPKIERAALDGTEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANR
VTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEE
LDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTC
ATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDK
SDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKSKPPSDESQPHSSA
IGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHG
TFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPAT
DRSLYNAEMFYSSNIPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDL
NSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091N7E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]