SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091PLM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PLM9
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 181-416
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 785-1044
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 4 Region: 2-130
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-28
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 739-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000314
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1175-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1097-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000194
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1137-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1054-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000981
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091PLM9
Sequence length 1462
Comment (tr|A0A091PLM9|A0A091PLM9_APAVI) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFP92425.1} KW=Complete proteome; Reference proteome OX=57397 OS=Apaloderma vittatum (Bar-tailed trogon). GN=N311_13005 OC=Apaloderma.
Sequence
FMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSN
LDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMD
IHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATEL
LLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFID
GSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRA
IVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAK
TDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIID
QLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVP
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSP
RALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDL
DTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQ
GHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCS
APTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIR
KAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGV
VLKGDHDRPRAIVVNPEKGYMYFTNLQDRSPKIERAALDGTEREVLFFSGLSKPIALAID
SQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKI
DMTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSC
PVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSD
AQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKNKKCDHNLD
CSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMT
NDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASS
SSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTT
PCSTDVCDSDYAPSRRVTTATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSP
YTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091PLM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]