SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091QZF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QZF5
Domain Number 1 Region: 419-674
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 118-353
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 722-981
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.0000373
Further Details:      
 
Domain Number 4 Region: 676-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1112-1150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1034-1072
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1074-1110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 70-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 10-67
Classification Level Classification E-value
Superfamily YWTD domain 0.000000288
Family YWTD domain 0.002
Further Details:      
 
Domain Number 10 Region: 382-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 991-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000849
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QZF5
Sequence length 1302
Comment (tr|A0A091QZF5|A0A091QZF5_MERNU) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFQ32915.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_08599 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
SARQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREVHSNIFSPMDIHA
FSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELLLL
ARRTDLRRISLDPPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRAGLDGAG
SQVVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVL
DPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDK
IEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLP
DLMGLKATNVHQIMGTTPWAEENGGCSHLCLYRPQGLRCACPIGLELISDMRTCIVPEAF
LLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNG
SALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRAL
ALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTN
LIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHL
DYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPT
TFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQ
EDGSQSLTVVTSPVPNQNLEMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVLR
GDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALAIDSQL
GKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMT
GREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVH
LVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDSQF
QCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSD
SSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDY
VVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSS
SSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSY
Download sequence
Identical sequences A0A091QZF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]