SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091RGT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RGT6
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.72e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1105
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-30
Family Ras-binding domain, RBD 0.00082
Further Details:      
 
Domain Number 3 Region: 226-359
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-22
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 
Domain Number 4 Region: 8-100
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000147
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091RGT6
Sequence length 1360
Comment (tr|A0A091RGT6|A0A091RGT6_9GRUI) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFQ38706.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_00649 OC=Mesitornis.
Sequence
MFRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAESISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPALCAGNSDNFAPKQRSFSDSAAIKFE
AGNECVSNPNLLSKEEISKVLNDDSVFRIGPESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSEKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGVARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKSNRVLVVDLGSNPSKHIPNSIWENPVGRGQNPPASHWNGFCHEPEGNI
PLEVVQNDKSQNVSKHLSPSARIEVPLVSSRNSVPPSKKGAAGVGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKTHKNEWSKKMFC
MQNKFGPPHSIRKSKEDKKGAKFGHAMGLNQAPPSRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGAFFSWSRSKSLG
KSQKRKENGDYPNDSIQSNGLSYRRESQGSMSSTASLDLSETSRLPAFIPDKDKSPKYCC
VNLPDGSSSKMAVKSGFSIKEVLSGVCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLSGEQEPL
DLGLPISNLDGQRVVLDEKEPTKGREGVCLCSMFTDKQKGASVKSATVTTSRSQVSTGEG
RTLGKSNSIKMKGENGKNAREVRLSKREDTIAKIGKKKCQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLILPDFLRLPPSGPEPSSSTPTGPKGLSKRVSKNDGKDGCTSPSGKQ
ESVQNFSENSVKKTSYSENKHKSALTALHSQKTFSVPFNTALSPIPHAQENNATIWKRQS
RELQAEGIQMVDDENVADLTLVAEGDISSPNNTLLPPPPP
Download sequence
Identical sequences A0A091RGT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]