SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091V1W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V1W0
Domain Number 1 Region: 618-873
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 7-266
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 317-552
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 921-1180
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 875-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1311-1349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1233-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 573-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000207
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1273-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 269-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1190-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000693
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091V1W0
Sequence length 1598
Comment (tr|A0A091V1W0|A0A091V1W0_NIPNI) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFQ96929.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_09113 OC=Nipponia.
Sequence
LLFKAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEEA
IKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFW
QELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTEIYWPNGLTLDYEEQ
KLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYS
GEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGV
KLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYI
YWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNG
TMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNG
LALDYVESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRS
IERVHKHTAEREIIIDQLPDLMGLKATNVRQIVGTNPCAEDNGGCSHLCLYRPQGLRCAC
PIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDN
RIYWTDISLKTISRAFMNGSALEHIVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKL
DGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRAN
GLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRS
IERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVC
GCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDP
LDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEA
TNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTERE
VLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFE
NWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGC
SHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFT
ECEDHSDEKNCPVCSDTQFQCESGQCIDGALRCNGEANCQDNSDEKNCEVLCLTDQFRCA
SGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFIC
QRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGG
SSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRS
YSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRS
QYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091V1W0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]