SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091VI47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VI47
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-50
Family YWTD domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 4 Region: 870-1134
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-38
Family YWTD domain 0.0000788
Further Details:      
 
Domain Number 5 Region: 1265-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 826-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000758
Family EGF-type module 0.036
Further Details:      
 
Domain Number 7 Region: 1227-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 1186-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000348
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1143-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000361
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091VI47
Sequence length 1545
Comment (tr|A0A091VI47|A0A091VI47_NIPNI) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFR02784.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_06903 OC=Nipponia.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIVSGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPLMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKEKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCMQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPDSFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQASLHGPFTVMSTPNQSQNPEKQPHDLS
IDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERA
PKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLE
DSNILQPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKRTRIQGRIAHLTGIHAVEELDME
EFSVHPCSRNNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGE
IDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEV
DCDTVCLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKTKPASDESQPHSSAIGPV
IGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTG
ISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSL
YNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDS
DPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A091VI47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]