SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093EXF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093EXF0
Domain Number 1 Region: 706-853
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.72e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1034-1131
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.78e-31
Family Ras-binding domain, RBD 0.00088
Further Details:      
 
Domain Number 3 Region: 215-368
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 8-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-20
Family PDZ domain 0.0094
Further Details:      
 
Domain Number 5 Region: 979-1048
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000222
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093EXF0
Sequence length 1373
Comment (tr|A0A093EXF0|A0A093EXF0_TYTAL) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFV46564.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_01864 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRTGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPTLCAGNSDNSAPKQRSFSISAAIKFE
TGNESVSNPNLLSKEEISKALNDDSVFRIGLESTEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPNSIWENPVGRGQNQPASHWNGFCHEQEGNI
PLEVIQNDKSQNVSKHLSPSARIEVPLVSSRNSVPPSKKNAAGIGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRCGVKCLIGGPPPPPMNKIPADRYRV
DGSFGQPQLKSHKNEWSKKMFCMQNKFGPPHSVRKSKEDKKGAKFGHPMGLNQAPPLRSS
VRRSFGRSKRFSITRSLDDLESATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLR
ERRVASWAVSFERLLQDPVGVKYFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYR
AREIFSKFLCSKATTPVNIDSQAQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKS
PLYQECILAEVEGRPLPDPQRVPSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESG
EEDTEKKKRGTFFSWSRSKSLGKSQKRKENGDYPNDSIQSNGLSYRRESQGSMSSTASLD
LSEASRLPAFVPDKEKSTKYCCINLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVD
LFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPV
VAKYGLNLNELVARLNGEQEPLDLGIPISNLDGQRVVLDEREPTKGRDKQKGASVKQSAT
VTTSRNQVSTGEGRTLGKSNSIKMKGENGKNAREVRLSKREDSIAKIGKKKCQKINLDEA
EEFFELISKAQSNRADDQRGLLRKEDLILPDFLRLPPTGPEPSSSTPAGPKGLNKRVSKN
DGKDGCTSPSGTQESVQNFNENSVKKMGYAENKHKSALTALHSQKTFSVPFNTALSPIPH
AQENNATIWKRQSRELQAEGIQMVDDENVADLTLVAEGDISSPNSTLLPPPPP
Download sequence
Identical sequences A0A093EXF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]