SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093GQN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GQN2
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-54
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-51
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 3 Region: 1-216
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-49
Family YWTD domain 0.00000371
Further Details:      
 
Domain Number 4 Region: 870-1134
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-37
Family YWTD domain 0.0000832
Further Details:      
 
Domain Number 5 Region: 1264-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1227-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1187-1225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family EGF-type module 0.038
Further Details:      
 
Domain Number 9 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000044
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 221-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000316
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1143-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093GQN2
Sequence length 1459
Comment (tr|A0A093GQN2|A0A093GQN2_DRYPU) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFV71643.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_07021 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
FWTDVSEEAIKQTSLNQSGSVVQNVIVSGLVSPDGLACDWVGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSARKIIVDSDIYWP
NGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEEDNGGCSHLCLLSPREP
FYSCACPTGVQLEDDGRTCKAGLEEVLLLARRTDLRRISLDTPDFTDIILQIDNIRHAIA
IDYDPAEGFLYWTDDDVRAIRRARLDGSGAQTLLTAEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGSARRVLVSDSLDEPRAIVLNPLLGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKQKLYWGDAKTDKIEVINIDGTMRRTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVSKVFGTNSCAENNGGCSHLCF
FTPQEARCACPMGLELLSDLKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQHRQVLLWKDLDNPRSLALDPTKGFMYWTEWGGKPRIVRAFMDGTNSL
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLEPNSRNCTSPASFLLFSQKSAISRMIPDDQQSPDLILPLHGLR
NVKALDYDPLDKFIYWVDGRQNIIKRAKDDGSQASPHSPFTVMSTPSQSQNPEKQPHDLS
IDVYSHTLYWTCEATNSVNVQRLSGEALGMVLRGEHDRPRAIALNAERGYMYFTNMQERA
PRIERAALDGTEREVLFTTGLLRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLE
DSNILQPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDME
EFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGE
IDCIPMAWRCDGFPECDDQSDEQGCPLCSAAQFQCGRGQCIEAHLRCNGDIDCQDKSDEA
DCHTICLPSQFRCASGQCILLKQQCDSFPDCIDGSDELLCEKTKPASDVSQPHSSAIGPV
IGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHDYVSGTPHVPLNFIAPGSSQHGTFTG
ISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSL
YNAEMFYSSNIPSTTRSYR
Download sequence
Identical sequences A0A093GQN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]