SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093H0E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093H0E3
Domain Number 1 Region: 567-822
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-55
Family YWTD domain 0.00000523
Further Details:      
 
Domain Number 2 Region: 266-496
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 2-215
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-46
Family YWTD domain 0.00000514
Further Details:      
 
Domain Number 4 Region: 869-1133
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-38
Family YWTD domain 0.0000757
Further Details:      
 
Domain Number 5 Region: 1264-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1226-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 522-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1185-1225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 825-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 220-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1143-1195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000318
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093H0E3
Sequence length 1544
Comment (tr|A0A093H0E3|A0A093H0E3_STRCA) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFV72562.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_14412 OC=Struthio.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGRERXXXXIVDSDIYWPN
GLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTR
SIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPF
YSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAI
DYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTD
RIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLV
NTSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYI
YWTDWQRRSIERVHKIRASRDIIIDQLPDLMGLKATSVTKVFGTNPCAENNGGCSHLCFF
TPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEAS
ALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTG
TNRIEVARLDGQFRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSIT
LVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYI
YWTDWNLHSIERADKTNGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCL
AIPNGFRCGCAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRN
VKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQASLPGPFTVMSTPNQSQNPEKQPHDLSI
DIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAP
KIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLED
SNILQPMGLTVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEE
FSAHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEI
DCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEAD
CDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKSKPASDEPQPHSSAIGPVI
GIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGI
SCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLY
NTEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSD
PYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A093H0E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]