SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093I599 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093I599
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.03e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1112
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-30
Family Ras-binding domain, RBD 0.00088
Further Details:      
 
Domain Number 3 Region: 220-368
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 9-99
Classification Level Classification E-value
Superfamily PDZ domain-like 4.39e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000282
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093I599
Sequence length 1355
Comment (tr|A0A093I599|A0A093I599_STRCA) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KFV87030.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_14031 OC=Struthio.
Sequence
MYRPGETVKRRLNVHAPPRIRSVEVARGRAGYGFTLSGQAPCILSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFEHPALCAGNSETSTPKQRSFSDSAAIKFE
TGNESMTNPNLLSKEEVSKVLNDDSVFRIGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPNSIWENPVGRGQNQSVSHWNGFCHEPEGNV
PLEVIQSDKSQNLSKHLSPSARIEVPLVSARNSVPPSKKSAAGIGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGPQHIIRKSKEEKKGAKFGHAVGLTQAPPQRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSTDLKDCVSENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGIK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDAEKKKRGTFFSWSRSKSLG
KSQKRKENGDYQNDSIQPNGLSYRRESQGSMSSAASLDLSEASRLPAFVPDKEKSPKYCS
VNLPDGSSSKMVVKSGFSIKEMLCGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLTELVARLNGEQEPL
DLGVPISNLDGQRVVLDEKEPTKGRVFTDKQKGASVKQSAAVTSSSRNQVSTGEGRALGK
SNSIKMKGENGKNARDVRLSKREDSIAKIGKKKSQKINLDEAEEFFELISKAQSNRADDQ
RGLLRKEDLILPDFLRLPPTGPEPSSSTPAGLKGLNKRVSKNDGKDGCASPSEKLESVQN
YNENSVKKMGYLENKHKSALTTVNSQKTCSVPFNTTLSPIPHAQENSTTIWKRQSRELHA
EGIQMVDDENVADLTLVAEGDISSPNSTLLPPPPP
Download sequence
Identical sequences A0A093I599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]