SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093NSS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093NSS5
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 3-262
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-55
Family YWTD domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 313-548
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 917-1174
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-38
Family YWTD domain 0.0000712
Further Details:      
 
Domain Number 5 Region: 871-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1305-1343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1227-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 569-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family EGF-type module 0.007
Further Details:      
 
Domain Number 9 Region: 1267-1303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 265-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1184-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000685
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093NSS5
Sequence length 1592
Comment (tr|A0A093NSS5|A0A093NSS5_PYGAD) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFW65030.1} KW=Complete proteome; Reference proteome OX=9238 OS=Pygoscelis adeliae (Adelie penguin). GN=AS28_10748 OC=Pygoscelis.
Sequence
AAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEEAIKRT
EFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELD
QPRAIALDPARGFMYWTDWGEVPKIERAGMDGSNRSIIVNTDIYWPNGLTLDYEEQKLYW
ADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDL
REIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLE
NGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTD
DEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRK
ILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALD
YAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERV
HKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADDNGGCSHLCLYRPQGLRCACPIGL
ELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYW
TDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQH
RQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTI
DYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERA
NKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPA
HYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQ
LYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVI
NVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFF
SGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSDRIVLEDSNILQPVGLTVFENWLYWI
DRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIV
KGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHS
DEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIG
KSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCP
RMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPY
DRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPY
SYRHFAPPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRSQYLSAE
ENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A093NSS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]