SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A093PMQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093PMQ1
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-50
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-49
Family YWTD domain 0.00000436
Further Details:      
 
Domain Number 4 Region: 870-1140
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-38
Family YWTD domain 0.0000873
Further Details:      
 
Domain Number 5 Region: 1271-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1192-1232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 7 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000359
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 1232-1268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000441
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1149-1202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A093PMQ1
Sequence length 1551
Comment (tr|A0A093PMQ1|A0A093PMQ1_9PASS) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KFW77691.1} KW=Complete proteome; Reference proteome OX=328815 OS=Manacus vitellinus (golden-collared manakin). GN=N305_03431 OC=Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae; Manacus.
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGAGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAFMDGTNSI
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQARNCSLCVVLQPFTVMSTPNQSQNPEK
QPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFT
NMQERAPKIERAALDGTEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGA
NRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAV
EELDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQF
TCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQ
DKSDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELICEKSKPASDESQPHS
SAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQ
HGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSP
ATDRSLYNAEMFYSSNIPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYI
DLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A093PMQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]