SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094K942 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094K942
Domain Number 1 Region: 1-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-114
Family Capz alpha-1 subunit 0.000000000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094K942
Sequence length 274
Comment (tr|A0A094K942|A0A094K942_ANTCR) F-actin-capping protein subunit alpha-2 {ECO:0000313|EMBL:KFZ55494.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_05991 OC=Antrostomus.
Sequence
KVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIDGYDE
QVLITEHGDLGNGKFLDPKNKISFKFDHLRKEATDPRPHEVENAIESWRNSVETAMKAYV
KEHYPNGVCTVYGKTIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVAGIL
KIQVHYYEDGNVQLVSHKDIQDSLTVSNEAQTAKEFIKIVEAAENEYQTAISENYQTMSD
TTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A087RGQ5 A0A091F940 A0A091GGX6 A0A091J2P4 A0A091JS21 A0A091JS45 A0A091LMW1 A0A091M8J0 A0A091QME8 A0A091QU03 A0A091RIV1 A0A091UJX5 A0A091V374 A0A093BRK9 A0A093H5X4 A0A093I0P7 A0A093NQS1 A0A093R2Y0 A0A094K942 A0A0A0AKG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]