SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A094MQ93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094MQ93
Domain Number 1 Region: 417-672
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 116-351
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 720-979
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 4 Region: 674-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1110-1148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1031-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 372-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 1072-1108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 68-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 10 Region: 8-65
Classification Level Classification E-value
Superfamily YWTD domain 0.000000183
Family YWTD domain 0.002
Further Details:      
 
Domain Number 11 Region: 989-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094MQ93
Sequence length 1348
Comment (tr|A0A094MQ93|A0A094MQ93_9AVES) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KFZ56776.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_01057 OC=Podiceps.
Sequence
RQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDIHAFS
QKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATELLLLAR
RTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFIDGSGSQ
FVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDP
MVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIE
VMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDL
MGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPEAFLL
FSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSA
LEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALAL
DPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLI
ESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDY
VMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTF
LLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQED
GSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVLKGD
QDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDSQLGK
LFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGR
EGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPIHLV
LLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQC
ESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKNKKCDHNLDCSDSS
DEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVV
HGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSS
TKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTD
VCDSDYAPSRRVTAATAKGYTSDLNYDS
Download sequence
Identical sequences A0A094MQ93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]