SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096MNR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MNR5
Domain Number 1 Region: 289-590
Classification Level Classification E-value
Superfamily Kelch motif 9.81e-63
Family Kelch motif 0.0000623
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily POZ domain 9.42e-33
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MNR5
Sequence length 620
Comment (tr|A0A096MNR5|A0A096MNR5_PAPAN) Kelch like family member 32 {ECO:0000313|Ensembl:ENSPANP00000001327} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=KLHL32 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MPSERCLSIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIAEEQKFHAHKAVL
AACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGS
HLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPE
DVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQHMDELLQYIRFGLMDVDT
LHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKRE
VCKVKELRYFNPVDQENALIATIANWSELAPMPVGRSHHCVAVMGDFLFVAGGEVEHASG
RTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYC
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPM
LQRRVYHSMAAVQRKLYVLGGNDLDYNNDRILVRHIDSYNMDTDQWTRCSFNLLTGQNES
GVAVHNGRIYLVGGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLPAP
YFTCPNLQTLQVPHHRIGTI
Download sequence
Identical sequences A0A096MNR5
ENSPANP00000001327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]