SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096P4K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P4K5
Domain Number 1 Region: 164-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-80
Family Eukaryotic proteases 0.00000000111
Further Details:      
 
Domain Number 2 Region: 47-159
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.0000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096P4K5
Sequence length 433
Comment (tr|A0A096P4K5|A0A096P4K5_PAPAN) Plasminogen activator, urokinase {ECO:0000313|Ensembl:ENSPANP00000020280} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PLAU OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MRALLAHLLLCVLVVSDSKGSRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQH
CEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNY
CRNPDNRRRPWCYVQVGLKQRVQECMVHNCADGKKPSSPPEELQFQCGQRTLRPRFKIVG
GEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGR
SRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLP
SMYNDPNDPPFGTSCEITGFGKENSTDYLYPEQLKMTVVKLVSHQKCQQPHYYGSEVTTK
MLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPW
IHSHTREQNGLAL
Download sequence
Identical sequences A0A096P4K5
ENSPANP00000020280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]