SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099Z2B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z2B7
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1112
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-30
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 220-369
Classification Level Classification E-value
Superfamily PH domain-like 8.78e-23
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 8-99
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000141
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099Z2B7
Sequence length 1354
Comment (tr|A0A099Z2B7|A0A099Z2B7_TINGU) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KGL75837.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_05387 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCILSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPALCAGNSETSTPKQRSFSDSAAIKFE
TGNESMNNPNLLSKEEISKVLNDDSVFRIGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAREDEGVLRTSCHVFMVDPELFHHKIHQGIARCFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDPDAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPNSIWENPVGRGQNQSASHWNGFCHEQEGNI
PLEVIQNDKSQNLSKHLSPSARIEVPLVSARNSVPPSKKSAAGTGNQRWLPVHVLQEWQH
GNVSDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGAFGQPQLKSHKNEWSKKMFC
MQNKFGPQHIIRKSKEDKKGAKFGHLLGLTQAPPQRSSARRSFGRSKRFSITRSLDDLES
ATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPIGIK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRKENGDYPNDSIQPNGLSYRRESQGSMSSTASLDLSEASRLPAFVPEKEKSPKYCS
VNLPDGSSSKMVVKSGFSIKEMLSGLCEKHGINIAAVDLFLIGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQEPL
DLGVPISNLDGQRVVLDEKEPTKGRVFTDKQKGASVKQSATVTTSSRNQVSTGEGRTLGK
SNSIKMKGENGKNARDVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQ
RGLLRKEDLILPDFLRLPPTAPEPSSSTPAGPKGLSKRVSKSDGKEGCTSPSGKLESVQN
YSENSVKKIGYSENKHKSALTAVSSQKTYSVPFNTALSPIPHAQESSTTVWKRQSRELQA
EAIQTVDDENVADLTLVAEGDISSPNSTLLPPPP
Download sequence
Identical sequences A0A099Z2B7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]