SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099Z6R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z6R5
Domain Number 1 Region: 609-864
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 2-261
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 312-543
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-47
Family YWTD domain 0.00000397
Further Details:      
 
Domain Number 4 Region: 912-1171
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 866-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000157
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1302-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1224-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 564-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1264-1300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 264-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1181-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099Z6R5
Sequence length 1508
Comment (tr|A0A099Z6R5|A0A099Z6R5_TINGU) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KGL77431.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_00698 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
APLLLYANRRDLRLVDATNGRENATVVVGGLEDAAAVDFMFAQGLIYWSDVSEEAIKRTE
FNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQ
PRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRAIIVNTDIYWPNGLTLDYEEQKLYWA
DAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYTGEDLR
EIHSNIFSPMDIHAFSQQRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLEN
GKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDD
EVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLRKILIAE
ELEEPRAIVLDPVAGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESK
IYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERVHKRTA
EREIIIDQLPDLMGLKATSVQQITGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELISD
MKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISL
KTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLV
WKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKR
RLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSG
QNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLN
SDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWID
SRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRL
DGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK
PIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQ
QQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNVQEYRLHPCSQDNGGCSHICIVKGD
GTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEK
NCPVCSEAQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSK
KCDHNLDCSDSSDEQGCYTTEEPAPQSNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMK
GDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRA
HVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYR
HFAPPTTP
Download sequence
Identical sequences A0A099Z6R5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]