SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0A6B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0A6B0
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 3-262
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 313-548
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 917-1176
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 871-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1307-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1229-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 569-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000216
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1269-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 265-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1186-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000471
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0A6B0
Sequence length 1594
Comment (tr|A0A0A0A6B0|A0A0A0A6B0_CHAVO) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:KGL88953.1} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_16304 OC=Charadrius.
Sequence
AAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEEAIKRT
QFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELD
QPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKLYW
ADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDL
REIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLE
NGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTD
DEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRK
ILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALD
YAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIERV
HKRTAEREIIIDQLPDLMGLKATNVRQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGL
ELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYW
TDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQH
RQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGLTI
DYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERA
NKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPA
HYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQ
LYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVI
NVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFF
SGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLY
WIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHIC
IVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECED
HSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQC
IGKSKKCDHNLDCNDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVL
CPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGP
PYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYR
PYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRSQYLS
AEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A0A0A6B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]