SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0ATB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0ATB4
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-49
Family YWTD domain 0.00000502
Further Details:      
 
Domain Number 3 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 870-1134
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-38
Family YWTD domain 0.0000779
Further Details:      
 
Domain Number 5 Region: 1265-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1227-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1186-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 523-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000473
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1144-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0ATB4
Sequence length 1545
Comment (tr|A0A0A0ATB4|A0A0A0ATB4_CHAVO) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:KGL96773.1} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_11145 OC=Charadrius.
Sequence
FWTDVSEEAIKQTYVNQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTNSCAENNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPVHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQASLCGPFTVMSTPNQSQNPEKQPHDLS
IDIYSHTLYWTCEATNSVNVHRLNGKSIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERA
PKIERAALDGTEREVLFTTGLIRPVALVIDNKIGKLFWVDADLKRIESCDLSGANRVTLE
DSNILQPMGLTVLGNHLYWIDRQQQMIERVEKMNGYKRTRIQGRIAHLTGIHAVEELDME
EFSAHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGE
IDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHFRCNGEIDCQDKSDEA
DCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKTKPASDESQPHSSAIGPV
IGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTG
ISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSL
YNAEMFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTSSRWKANKYYIDLNSDS
DPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A0A0ATB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]