SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0LRE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0LRE7
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-22
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 274-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-17
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0LRE7
Sequence length 395
Comment (tr|A0A0A0LRE7|A0A0A0LRE7_CUCSA) Uncharacterized protein {ECO:0000313|EMBL:KGN62556.1} KW=Complete proteome; Reference proteome OX=3659 OS=Cucumis sativus (Cucumber). GN=Csa_2G360730 OC=Benincaseae; Cucumis.
Sequence
MDKVGDSSNKWAEDIYWSHFQFTHFYQILAGGCEQQLVIPNKFSNNLRNKLPDTVTLKGP
SGATWDVGLTSSDDKLYFKRGWQEFVKAHSLEQNDLLVFRYNGMSQFDVLIFDWKSFCEK
EASYFVKICENKKIDSGGQAKRKFREPSLDGFDANINNGAECDSSENIIHDDSMERMIQD
VVSKATNFNGQPEVFSAEPIRTVQTRRKKKTPNKTAIISTPDPVQLSDSDVEATPIKKIG
SYVEQYVSHRRAITEGEKNNALKLAEAASSDTGFKVVMRPSHVYRRFFLFIPTQWVTKNL
SLRNQDIILRVGSDEWPTKFNFTPSRQCGGLTSGWKHFSVDNNLEEFDVCVFEPVNKSSG
PVVLEVKIFRVVEDVIPLTRVASKGNRKPTKAPEA
Download sequence
Identical sequences A0A0A0LRE7
Cucsa.232520.1|PACid:16970267 XP_004152721.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]