SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0MRN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MRN7
Domain Number 1 Region: 40-260
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.31e-61
Family AAT-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MRN7
Sequence length 262
Comment (tr|A0A0A0MRN7|A0A0A0MRN7_HUMAN) Kynurenine--oxoglutarate transaminase 3 {ECO:0000313|Ensembl:ENSP00000359517} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KYAT3 OC=Catarrhini; Hominidae; Homo.
Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKI
Download sequence
Identical sequences A0A0A0MRN7
ENSP00000359517 ENSP00000359517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]