SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0NH16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0NH16
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-78
Family Protein kinases, catalytic subunit 0.000000031
Further Details:      
 
Domain Number 2 Region: 517-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000693
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 452-511
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  A0A0A0NH16
Domain Number - Region: 381-443
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 
Domain Number - Region: 586-646
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0NH16
Sequence length 670
Comment (tr|A0A0A0NH16|A0A0A0NH16_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:AGP56496.1} KW=Complete proteome OX=1343740 OS=Streptomyces rapamycinicus NRRL 5491. GN=M271_25015 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTT
GILQALEYSHRNNIVHRDIKPANVMLTRDGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQPPSTYD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALGAVGYGSDDQPT
AMLRPQNSGAGAQTSMLPPMREDDGGFGYDERPDRGRGRGGPGKKSNLSTILLIIAGILV
LVGAIFIGKSLFAGGKNDDMVPVPNLVGKTIEDAKSQGENGDFKVKNVGSKFCANADKNT
VCEQTPKGGDEVKRYGTVELTMSKGPKPAARVEVPDVLNVQYESAKQQLEAKGFTVDQKT
EQSDQTAGKVIDQDPKGGKKVAKGATITLTVAEAQQKVVVPDVTTQKVEDATKSLQGKGL
KVQTQEVENGDVEAGTVTDQTPKGGQEVLPGSTVTLTVAKEPAQDENVPVPNLGGQKLKD
AKKALQDLGLNVGNIAGPQDDNASVVASQPGAGTQVPKGQSVNLITVAGQGGNGGGGDNG
GGIFGGQNGF
Download sequence
Identical sequences A0A0A0NH16
gi|557687892|ref|YP_008791419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]