SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A1U056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A1U056
Domain Number - Region: 25-114
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1U056
Sequence length 220
Comment (tr|A0A0A1U056|A0A0A1U056_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP85856.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_282370 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEETEYVLTKNDTCQYLESIKFDFAKEKEAKKLKTENDEIKEEVKNLANDKDQLSSEKKK
LQYEYDQLINLVSVHEDETNNLNGSIKKLQRDFCKILEANNTENIADLEQQVQDLEYRPV
GTSNIDKTEVIKRDNQIVDLEKAVAVLKEQNTQLDAAKKDMKKQLKTLWRLRIMDHRLRH
LKHKRRWLWTTKRRLRRLQRTNLIEEKNMEDQAKALNAQV
Download sequence
Identical sequences A0A0A1U056
XP_004185202.1.21224 jCVI|EIN_166770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]