SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1VPT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1VPT8
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.1e-18
Family Ribosomal protein L33p 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1VPT8
Sequence length 64
Comment (tr|A0A0A1VPT8|A0A0A1VPT8_MICAE) 50S ribosomal protein L33 {ECO:0000256|HAMAP-Rule:MF_00294} KW=Complete proteome OX=449439 OS=Microcystis aeruginosa NIES-44. GN=N44_01451 OC=Microcystaceae; Microcystis.
Sequence
MASKKGVRLIITVECTECRSNPDKRTPGVSRYTTSKNRRNTTGRLEIKKYCPHCNKHTVH
KEIK
Download sequence
Identical sequences A0A0A1VPT8 A0A0F6RN50 A0A0K1S2S2 A0A1E4QHA0 A0A1V4BNW4 A0A1X9LGT2 A0A2H6BVQ2 A0A2H6LAK4 A8YF81 B0JVN3 I4F8C6 I4FMW2 I4G8C7 I4GI42 I4GYV9 I4HBF9 I4HUA0 I4I3Y6 I4IES3 I4IT36 L7EDY0 L8P278 S3JEK2
gi|166367545|ref|YP_001659818.1| WP_002734724.1.10452 WP_002734724.1.13945 WP_002734724.1.15998 WP_002734724.1.20667 WP_002734724.1.23084 WP_002734724.1.24258 WP_002734724.1.39664 WP_002734724.1.4043 WP_002734724.1.42333 WP_002734724.1.43950 WP_002734724.1.43975 WP_002734724.1.50331 WP_002734724.1.50673 WP_002734724.1.52201 WP_002734724.1.5315 WP_002734724.1.62741 WP_002734724.1.6707 WP_002734724.1.77316 WP_002734724.1.7764 WP_002734724.1.79847 WP_002734724.1.86711 WP_002734724.1.88161 WP_002734724.1.92877 WP_002734724.1.98808 449447.MAE_48040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]