SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1WNW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1WNW1
Domain Number 1 Region: 82-265
Classification Level Classification E-value
Superfamily Kelch motif 1.28e-43
Family Kelch motif 0.00077
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 6.93e-16
Family Galactose oxidase, central domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1WNW1
Sequence length 319
Comment (tr|A0A0A1WNW1|A0A0A1WNW1_ZEUCU) Kelch-like protein 1 {ECO:0000313|EMBL:JAD00326.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.34959 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MEKVWIQCGVLKFPKRSPSLVYSDKHLISLGGFSDDETPSNGVFAYSLQTEEWKTLKPMS
VPRVDLCVVIVNKFIYVLGESGSNPCVALKTAEKFNHCTRQWISLPDMFMARSQATAVAL
DDQIYIMGGLASNGRPLKSVECFNTITGKWDRCGDMIQPRFDFGAAFFKGLLYVIGSGNT
MHSMHSLSCSVECYNPKTNTWSQAASINVPRYGICGITLTDRLMAIGGTTLTDFKGIIEV
YKPTKNSWLQGKPLPMGGNYRCFVVPSKELTEIQSKPNEIVIAPKRLLHTSLLLLMRMYF
FIRWLLCLGKCIILWTIRN
Download sequence
Identical sequences A0A0A1WNW1
XP_011187300.1.96551 XP_011187301.1.96551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]