SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A7U0D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7U0D1
Domain Number 1 Region: 15-426
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.44e-89
Family beta-CASP RNA-metabolising hydrolases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A7U0D1
Sequence length 559
Comment (tr|A0A0A7U0D1|A0A0A7U0D1_LACBR) Ribonuclease J {ECO:0000256|HAMAP-Rule:MF_01491} KW=Complete proteome OX=1334191 OS=Lactobacillus brevis BSO 464. GN=L747_06075 OC=Lactobacillus.
Sequence
MNKLNVKNNETAIFGVGGLGEIGKNTYGIQFQDEIILIDAGIKFPEDELLGIDYVIPDYQ
YLVENQAKIKALVITHGHEDHIGGIPYLLKALNVPVYAGPLALALIKNKLEEHGLLKSTE
LHAIDDDTVLKFRKMSVSFFRTTHSIPDTLGVAVHTPVGVIVETGDYKFDLTPVTNQPPD
LQKMAKLGAEGILCLMSDSTNAERPIWTKSEKWVGKSIRKIFDQVEGRVIFATFASNISR
IETACETALAHGRKIAVFGRSMEAAIVNGRELGYLNIPDDALVDANAIRSLPANKVMILC
TGSQGEPMAALSRIANGTHRQIAIQPGDTVVFSSNPIPGNTISVNRVINELEEAGANVIH
GKVNNIHTSGHGGQEEQKLMLRLMQPKFFMPIHGEYRMLKIHTELAEQCGVPLDHSFILQ
NGDVLALTKDSARVAGHFTAGDVYIDGSGIGDIGNVVLRDRQLLSEEGLVVVVATIDLKN
QEIKAGPDLLSRGFVYMRESGELLNEGRRRVFQTIRRAMRNPKATEASIRNAVIDDLQNF
LFEKTERHPMILPMFIMTK
Download sequence
Identical sequences A0A0A7U0D1 A0A0C1Q1X9 M5ADY7 Q03QL0 U2QM07
gi|116334016|ref|YP_795543.1| WP_011668085.1.101817 WP_011668085.1.101959 WP_011668085.1.10245 WP_011668085.1.12110 WP_011668085.1.12992 WP_011668085.1.14555 WP_011668085.1.30569 WP_011668085.1.33510 WP_011668085.1.34389 WP_011668085.1.35844 WP_011668085.1.41999 WP_011668085.1.47372 WP_011668085.1.49372 WP_011668085.1.51823 WP_011668085.1.56537 WP_011668085.1.57633 WP_011668085.1.61846 WP_011668085.1.6335 WP_011668085.1.63668 WP_011668085.1.67033 WP_011668085.1.67380 WP_011668085.1.68109 WP_011668085.1.71826 WP_011668085.1.74392 WP_011668085.1.78399 WP_011668085.1.79023 WP_011668085.1.80197 WP_011668085.1.8329 WP_011668085.1.85477 WP_011668085.1.86233 WP_011668085.1.86414 WP_011668085.1.92695 387344.LVIS_1414 gi|472407094|ref|YP_007654199.1| LbR20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]