SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B1ZRK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1ZRK0
Domain Number 1 Region: 246-507
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.06
Further Details:      
 
Domain Number 2 Region: 24-229
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0087
Further Details:      
 
Domain Number 3 Region: 522-629
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.08e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1ZRK0
Sequence length 648
Comment (tr|A0A0B1ZRK0|A0A0B1ZRK0_9SPHN) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KHK91904.1} KW=Complete proteome; Reference proteome OX=1348853 OS=Novosphingobium malaysiense. GN=LK12_08610 OC=Sphingomonadaceae; Novosphingobium.
Sequence
MATITAEHETEASVQDTAPEAVVVRFAGDSGDGMQLTGGQFTLSTALAGNDLATFPDFPA
EIRAPQGTLFGVSAFQINFGSQEITTAGDAPDVLVAMNPAALKVNVQALKPGGLVIADTG
EFSKRNLDKAKYETNPLEDDSLAKWDVLAFDISALTLEAVKPFGLGNKEALRCKNMWTLG
LALWMFDRDRQPLVDWLKNKFAKNPVLADANIAALNAGHAYGETAELAGPLKKLHVDPVP
SEPGLYRTITGAEAVSLGLVAGAQLADLPMFFGGYPITPASAILHNLVKMKEFGVTTFQA
EDEIAAICAAIGASYAGQLGVTSSSGPGIALKGEAMGLAVMTELPLVIVNSQRGGPSTGL
PTKTEQSDLYQAVYGRNGDASLPVVAARSPADAFECAIEACRIAVQFMTPVMLLTDGYIG
NASEPWKVPDPASFEPFPVSFLEKNNNPDGNVLPFKRDARGVRPWIKPGTEGLMHRIGGI
EKGIDTGNIDYAPQVHQAQTDARKAKVDGVAAAIPPQDVCLGEESGKLAVVGWGSTFGPI
HQAVRRARRKGMDVSHIHVRHVWPLPGNLGDLLKGFDKVLVPEMNTGQFKTVLRDQFLVD
ATPLSKTSGQPFAIAEIEEAIASYFDGVPGHAEGEVPVNETQLPNPEA
Download sequence
Identical sequences A0A0B1ZRK0
WP_039284994.1.59725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]