SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B5GZD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5GZD1
Domain Number 1 Region: 11-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-41
Family Extended AAA-ATPase domain 0.0012
Further Details:      
 
Domain Number 2 Region: 286-386
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.31e-21
Family Helicase DNA-binding domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5GZD1
Sequence length 414
Comment (tr|A0A0B5GZD1|A0A0B5GZD1_9EURY) ORC1-type DNA replication protein {ECO:0000256|HAMAP-Rule:MF_01407} KW=Complete proteome OX=1592728 OS=Haloarcula sp. CBA1115. GN=SG26_18060 OC=Haloarcula.
Sequence
MGMFERDTEIYLDRDALREDYQPENLVGRDTELNRYRAALQPVINGEQPNNIFLYGKTGV
GKTAGTRYLIDHLEEDAAKYEDIDLTVKMLNCDGLSSSYQIATRLVNEFRDETSQISTTG
YPRATVYDMLWTELDSCGGTIYIVLDEVDHIEDDSILYQLPRARANDNLSSAKIGIIGIS
NDFSFRDDLSPKVKSSLCEEEIQFPAYDAKELIQILQQRADVAFHDGVLEDGVIELCAAY
GAKDAGDARQSLDLLMKTGDLARDKDTDTISEDLVREARDVLERGRIQEGISGLTQHGHL
VVYAMVTLDQEGKTPARTRDIRPRYTNFAEKAGIDPLVPRRMRDHLGELSMLGIISAIER
NEGRRGGTYREYSLEMDPEMILAALEKTVDDVGIHKSVTNLVDSEATLSDFQST
Download sequence
Identical sequences A0A0B5GZD1 A0A165L9P3 G0HZR4 M0KD80 M0L0U9 V5TRT9
gi|564287958|ref|YP_008874149.1| gi|344209943|ref|YP_004786119.1|NC_015944 gi|564287958|ref|YP_008874149.1|NC_023012 gi|344209943|ref|YP_004786119.1| WP_004594978.1.13069 WP_004594978.1.18001 WP_004594978.1.27393 WP_004594978.1.67629 WP_004594978.1.92404 WP_004594978.1.92869 WP_004594978.1.94779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]