SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7AV25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7AV25
Domain Number 1 Region: 146-238
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000222
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7AV25
Sequence length 238
Comment (tr|A0A0B7AV25|A0A0B7AV25_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK83730.1} OX=1028688 OS=Arion vulgaris. GN=ORF138739 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MSKAFNVYRGTSPTTQNRLESRLRELEDALDSERDGRVRAEKLLAELQFKIDQLQDSLDE
QTVVTLQQTELSKKRETEINKLRKDVEMVNAQFEQTENGLRKRHQEAIHELSDQIEHLQK
QKARVEKEKQTLVVELDGISGQLDLLSKAKASVESKLDSSEQANVRLKGQVDDFARQLND
LTSIKAKLTQENFDLQHQVQELDSSNASLAKAKSQLQHQNDDLKRNLDDETRQRQNLQ
Download sequence
Identical sequences A0A0B7AV25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]