SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B7LBS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7LBS1
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000128
Family Apolipoprotein 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7LBS1
Sequence length 418
Comment (tr|A0A0B7LBS1|A0A0B7LBS1_STREE) Competence-induced protein Ccs50 {ECO:0000313|EMBL:CRH98613.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS019416_00661 OC=Streptococcus.
Sequence
MESLLILLLIANLAGLFLIWQRQDRQEKHLSKSLEDQADHLSDQLDYRFDQARQASQLDQ
KDLEVAVSDRLQEVRIELHQGLTQVRQEMTDNLLQTRDKTDQRLQALQESNEQRLEQMRQ
TVEEKLEKTLQTRLQASFETVSKQLESVNRGLGEMQTVARDVGALNKVLSGTKTRGILGE
LQLGQIIEDIMTPAQYEREYATVENSSERVEYAIKLPGQGDQEYVYLPIDSKFPLADYYR
LEEAYETGDKDEIERCRKSLLASVKRFAKDIKSKYIAPPRTTNFGILFVPTEGLYSEIVR
NPVFFDDLRREEQIIVAGPSTLSALLNSLSVGFKTLNIQKSADHISKTLASVKTEFGKFG
GILVKAQKHLQHASGNIDELLNRRTIAIERTLRHIELSEGEPALDLLHFQENEEEYED
Download sequence
Identical sequences A0A0B7LBS1 C1CA25
488221.SP70585_2052 gi|405760144|ref|YP_006700740.1| gi|225859736|ref|YP_002741246.1| gi|307068589|ref|YP_003877555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]