SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1KGW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1KGW3
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.88e-48
Family Phosphoglucomutase, first 3 domains 0.00052
Further Details:      
 
Domain Number 2 Region: 155-255
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-30
Family Phosphoglucomutase, first 3 domains 0.00038
Further Details:      
 
Domain Number 3 Region: 257-364
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.46e-30
Family Phosphoglucomutase, first 3 domains 0.0068
Further Details:      
 
Domain Number 4 Region: 357-444
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.7e-18
Family Phosphoglucomutase, C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1KGW3
Sequence length 446
Comment (tr|A0A0C1KGW3|A0A0C1KGW3_9PSED) Phosphoglucosamine mutase {ECO:0000256|HAMAP-Rule:MF_01554, ECO:0000256|RuleBase:RU004327, ECO:0000256|SAAS:SAAS00639982} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_11725 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSRKYFGTDGIRGRVGEYPITPDFMLKLGWAAGMAFRKQGHCRVLVGKDTRISGYMFESA
LEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQGTKL
PDEVELMIEELLDQPMTVVESGKLGKVSRINDAAGRYIEFCKSSVPTSTSFDGLKLVVDC
AHGATYKVAPSVFRELGAEVTVLHAQPDGLNINEGCGSTHIESLQAAVLVGHADLGIAFD
GDGDRVLMVDHTGAIVDGDELLFIIARDLQERGKLQGGVVGTLMSNLGLELALKELDVPF
VRAKVGDRYVMAELLEREWLVGGENSGHVVCCNHTTTGDAIIAALQVLMALKRRGETLAQ
ARQALRKCPQVLINVRYGASKVDPLEHPAVKEASAKVTEALAGRGRVLLRKSGTEPLVRV
MVEGEDESQVRAHAEALAKLVGEVCV
Download sequence
Identical sequences A0A099N4G5 A0A0C1KGW3 A0A0P7CSL2 F8G6H3 V9V3A0
gi|568184079|ref|YP_008956770.1| 2035966890 gi|568189452|ref|YP_008962133.1| WP_013974287.1.23948 WP_013974287.1.28354 WP_013974287.1.56258 WP_013974287.1.57632 WP_013974287.1.65739 WP_013974287.1.7288 WP_013974287.1.7435 WP_013974287.1.80759 gi|339489445|ref|YP_004703973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]